Difference between revisions of "Protein modelling"
Line 23: | Line 23: | ||
− | <div id=" | + | |
− | + | ||
− | + | <div id="kbektt12941" style="overflow:auto;height:1px;"> | |
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
[http://www.appendicitisfoundation.org/anyboard9/AppendicitisFoundation/AppendicitisFoundationFeedback/posts/9.html buy ambien] | [http://www.appendicitisfoundation.org/anyboard9/AppendicitisFoundation/AppendicitisFoundationFeedback/posts/9.html buy ambien] | ||
[http://www.chospice.org/boards/forum2/posts/14.html free ringtones] | [http://www.chospice.org/boards/forum2/posts/14.html free ringtones] | ||
Line 143: | Line 76: | ||
[http://crossroadsccenter.com/directory_name/discussions/posts/63.html Shakira concert tickets] | [http://crossroadsccenter.com/directory_name/discussions/posts/63.html Shakira concert tickets] | ||
[http://crossroadsccenter.com/directory_name/discussions/posts/64.html Pink concert tickets] | [http://crossroadsccenter.com/directory_name/discussions/posts/64.html Pink concert tickets] | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/5.html buy ambien] | [http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/5.html buy ambien] | ||
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/6.html buy adipex] | [http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/6.html buy adipex] | ||
Line 162: | Line 81: | ||
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/8.html buy carisoprodol] | [http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/8.html buy carisoprodol] | ||
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/9.html buy hydrocodone] | [http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/9.html buy hydrocodone] | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
[http://www.appli.se/rebecca/anyboard/myboard/posts/51.html buy ambien] | [http://www.appli.se/rebecca/anyboard/myboard/posts/51.html buy ambien] | ||
[http://www.appli.se/rebecca/anyboard/myboard/posts/52.html buy adipex] | [http://www.appli.se/rebecca/anyboard/myboard/posts/52.html buy adipex] | ||
Line 207: | Line 113: | ||
[http://www.orangefridge.com/anyboard9/ryan/posts/166.html buy carisoprodol] | [http://www.orangefridge.com/anyboard9/ryan/posts/166.html buy carisoprodol] | ||
[http://www.orangefridge.com/anyboard9/ryan/posts/167.html buy hydrocodone] | [http://www.orangefridge.com/anyboard9/ryan/posts/167.html buy hydrocodone] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/168.html free ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/169.html nextel ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/170.html free nokia ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/171.html verizon ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/172.html free sprint ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/173.html motorola ringtones] | ||
+ | [http://che.es/compraventa/posts/14635.html buy ambien] | ||
+ | [http://che.es/compraventa/posts/14706.html buy adipex] | ||
+ | [http://che.es/compraventa/posts/14716.html buy xenical] | ||
+ | [http://che.es/compraventa/posts/14769.html buy carisoprodol] | ||
+ | [http://che.es/compraventa/posts/14860.html buy hydrocodone] | ||
+ | [http://che.es/compraventa/posts/14914.html free ringtones] | ||
+ | [http://che.es/compraventa/posts/15001.html nextel ringtones] | ||
+ | [http://che.es/compraventa/posts/15047.html free nokia ringtones] | ||
+ | [http://che.es/compraventa/posts/15105.html verizon ringtones] | ||
+ | [http://che.es/compraventa/posts/15187.html free sprint ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/174.html download ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/175.html cingular ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/176.html sprint ringtones] | ||
+ | [http://www.orangefridge.com/anyboard9/ryan/posts/177.html polyphonic ringtones] | ||
+ | [http://che.es/compraventa/posts/15241.html motorola ringtones] | ||
+ | [http://che.es/compraventa/posts/15338.html download ringtones] | ||
+ | [http://che.es/compraventa/posts/15414.html cingular ringtones] | ||
+ | [http://che.es/compraventa/posts/15424.html sprint ringtones] | ||
+ | [http://che.es/compraventa/posts/15435.html polyphonic ringtones] | ||
+ | [http://che.es/compraventa/posts/15512.html cell phone wallpapers] | ||
+ | [http://che.es/compraventa/posts/15532.html prepaid cell phones] | ||
+ | [http://che.es/compraventa/posts/15587.html mp3 ringtones] | ||
+ | [http://che.es/compraventa/posts/15666.html cell phone ringtones] | ||
+ | [http://che.es/compraventa/posts/15675.html download free ringtones] | ||
+ | [http://che.es/compraventa/posts/15706.html t-mobile ringtones] | ||
+ | [http://che.es/compraventa/posts/15757.html nokia ringtones] | ||
+ | [http://che.es/compraventa/posts/15801.html free cingular ringtones] | ||
+ | [http://che.es/compraventa/posts/15830.html Justin Timberlake concert tickets] | ||
+ | [http://che.es/compraventa/posts/15883.html Shakira concert tickets] | ||
+ | [http://che.es/compraventa/posts/15899.html motorcycle trailer] | ||
+ | [http://che.es/compraventa/posts/16037.html Pink concert tickets] | ||
+ | [http://www.ohiospice.com/forum1/posts/11971.html buy ambien] | ||
+ | [http://www.ohiospice.com/forum1/posts/11972.html buy adipex] | ||
+ | [http://www.ohiospice.com/forum1/posts/11975.html buy xenical] | ||
+ | [http://www.ohiospice.com/forum1/posts/11976.html buy carisoprodol] | ||
+ | [http://www.ohiospice.com/forum1/posts/11977.html buy hydrocodone] | ||
+ | [http://www.ohiospice.com/forum1/posts/11978.html free ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11979.html nextel ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11980.html free nokia ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2270.html free ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2271.html nextel ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2272.html free nokia ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2273.html verizon ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2274.html free sprint ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2275.html motorola ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2276.html download ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2277.html cingular ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2278.html sprint ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2279.html polyphonic ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2280.html cell phone wallpapers] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2281.html prepaid cell phones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2282.html mp3 ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2283.html cell phone ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2284.html download free ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2285.html t-mobile ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2286.html nokia ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2287.html free cingular ringtones] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2288.html Justin Timberlake concert tickets] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2289.html Shakira concert tickets] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2290.html motorcycle trailer] | ||
+ | [http://fudan7819.phm.utoronto.ca/fudan7819/posts/2291.html Pink concert tickets] | ||
+ | [http://www.ohiospice.com/forum1/posts/11984.html verizon ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11985.html free sprint ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11986.html motorola ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11987.html download ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11988.html cingular ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11989.html sprint ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11990.html polyphonic ringtones] | ||
+ | [http://www.ohiospice.com/forum1/posts/11991.html cell phone wallpapers] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/167.html buy ambien] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/168.html buy adipex] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/169.html buy xenical] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/170.html buy carisoprodol] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/171.html buy hydrocodone] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/172.html free ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/173.html nextel ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/174.html free nokia ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/175.html verizon ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/176.html free sprint ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/177.html motorola ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/178.html download ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/179.html cingular ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/180.html sprint ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/181.html polyphonic ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/182.html cell phone wallpapers] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/183.html prepaid cell phones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/184.html mp3 ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/185.html cell phone ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/186.html download free ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/187.html t-mobile ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/188.html nokia ringtones] | ||
+ | [http://www.casstelephone.com/bbs/general/posts/189.html free cingular ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/11.html buy ambien] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/12.html buy adipex] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/15.html buy xenical] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/16.html buy carisoprodol] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/17.html buy hydrocodone] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/18.html free ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/19.html nextel ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/20.html free nokia ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/21.html verizon ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/22.html free sprint ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/23.html motorola ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/24.html download ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/25.html cingular ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/26.html sprint ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/27.html polyphonic ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/28.html cell phone wallpapers] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/29.html prepaid cell phones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/30.html mp3 ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/31.html cell phone ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/32.html download free ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/33.html t-mobile ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/34.html nokia ringtones] | ||
+ | [http://patriotnews.com/anyboard9/mud/posts/35.html free cingular ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/9.html buy ambien] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/10.html buy adipex] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/11.html buy xenical] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/12.html buy carisoprodol] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/13.html buy hydrocodone] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/14.html free ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/15.html nextel ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/16.html free nokia ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/17.html verizon ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/18.html free sprint ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/19.html motorola ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/20.html download ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/21.html cingular ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/22.html sprint ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/23.html polyphonic ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/24.html cell phone wallpapers] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/25.html prepaid cell phones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/26.html mp3 ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/27.html cell phone ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/28.html download free ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/29.html t-mobile ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/30.html nokia ringtones] | ||
+ | [http://www.drbradsadvice.com/anyboard9/forum/posts/31.html free cingular ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/38.html buy ambien] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/39.html buy adipex] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/40.html buy xenical] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/41.html buy carisoprodol] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/42.html buy hydrocodone] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/43.html free ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/44.html nextel ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/45.html free nokia ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/46.html verizon ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/47.html free sprint ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/48.html motorola ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/49.html download ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/50.html cingular ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/51.html sprint ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/52.html polyphonic ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/53.html cell phone wallpapers] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/54.html prepaid cell phones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/55.html mp3 ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/56.html cell phone ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/57.html download free ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/58.html t-mobile ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/59.html nokia ringtones] | ||
+ | [http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/60.html free cingular ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/71.html buy ambien] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/72.html buy adipex] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/73.html buy xenical] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/74.html buy carisoprodol] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/75.html buy hydrocodone] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/76.html free ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/77.html nextel ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/78.html free nokia ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/79.html verizon ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/80.html free sprint ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/81.html motorola ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/83.html download ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/84.html cingular ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/85.html sprint ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/86.html polyphonic ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/87.html cell phone wallpapers] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/88.html prepaid cell phones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/89.html mp3 ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/90.html cell phone ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/91.html download free ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/92.html t-mobile ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/93.html nokia ringtones] | ||
+ | [http://www.getechnet.com/board/board/forum/posts/94.html free cingular ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1885.html buy ambien] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1886.html buy adipex] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1887.html buy xenical] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1888.html buy carisoprodol] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1889.html buy hydrocodone] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1890.html free ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1891.html nextel ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1892.html free nokia ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1893.html verizon ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1894.html free sprint ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1895.html motorola ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1896.html download ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1897.html cingular ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1898.html sprint ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1899.html polyphonic ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1900.html cell phone wallpapers] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1901.html prepaid cell phones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1902.html mp3 ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1903.html cell phone ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1904.html download free ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1905.html t-mobile ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1906.html nokia ringtones] | ||
+ | [http://www.vultureviews.net/dafurrboard/posts/1907.html free cingular ringtones] | ||
</div> | </div> |
Revision as of 15:47, 1 November 2006
== 단백질 구조 모델링 실용 안내서==
[1]
===Problem (문제정의)===
* Build 3D structural models of given or interested proteins
** Initial input: amino acid sequence of the target protein
** Final output: its predicted 3D structure
===Method===
* Find one or more structural templates of the target protein via sequence homology search against known structures (program: BLASTP or PSI-BLAST, database: PDB)
* Download template structures in PDB format (web server: RCSB PDB)
* Align the amino acid sequence of the target protein with that(those) of the template protein(s) (program: CLUSTALW, output: PIR format)
* Build 3D structural models based on the multiple sequence alignment and the template 3D structure(s) (program: MODELLER, input: ATM, ALI, and TOP files)
** manual build
*** manually convert file formats from PDB to ATM and PIR to ALI, respectively
*** write a TOP script file
*** run MODELLER
** automatic build (some PDB and PIR files are not successfully converted to correct ATM and ALI files due to amino-acid sequence mismatch)
*** perl script to generate ATM, ALI, and TOP files from PDB and PIR files: txt, gz
*** command-line arguments in order: base_directory_path pir_file_name target_protein_id(exactly 4 letters) one_or_more_PDB_file_names(exactly 4-letter prefix)
*** run the perl script (e.g. ../bin/makeModellerInput.pl /home/user/Protein3DModelling/KCIP KCIP.pir KCIP 1QJA.pdb)
*** run MODELLER (e.g. mod7v7 KCIP.top)
** example
*** ATM file: 5fd1.atm
*** ALI file: alignment.ali
*** TOP file: model-default.top
*** command: mod7v7 model-default.top
*** output PDB file (predicted model): 1fdx.B99990001.pdb
** MODELLER manual
*** PDF, HTML
* Display and compare the 3D structures of the model and the template proteins (program: RasMol)
=== Sample proteins (단백질 예제들)===
* Sample protein A: 14-3-3 protein gamma (Protein kinase C inhibitor protein-1; KCIP-1) >sw|P61981|143G_HUMAN 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWR VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKV FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV FYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD GGEGNN * Sample protein B: GAK_HUMAN Cyclin G-associated kinase (GAKH) >sw|O14976|GAK_HUMAN Cyclin G-associated kinase MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
=== Available Online Tool Servers ===
# BLASTP: ## 'NCBI BLASTP' ## EBI SRS BLASTP
# PSI-BLAST:
## 'NCBI PSI-BLAST'
# CLUSTALW:
## 'EBI ClustalW',
## 'Genebee ClustalW' # SRS servers: 'NGIC SRS', 'Public SRS servers' # Search engine: Google (Search online servers by yourself!)
===Available Online Databases ===
# PDB amino-acid FASTA file: NCBI BLAST DB (local: pdbaa.gz) # PDB: ## RCSB, ## 'UK PDB mirror',
## 'Japan PDB mirror' ===Downloadable programs=== # BLAST: ftp://ftp.ncbi.nlm.nih.gov/blast/executables/release/ (local: DOS) # CLUSTALW: ftp://ftp.ebi.ac.uk/pub/software/dos/clustalw/ (local: DOS[WindowsXP]) # MODELLER: http://salilab.org/modeller/ (local: DOS) # RasMol: http://www.openrasmol.org/ (local: Windows) # Perl: http://www.perl.org/ (local: DOS[WindowsXP]) # Other utilities: ALZip.exe (for unzip, untar, and ungzip)
===Solution Example ===
# Found templates (PDB format) ## Sample protein A: 1QJA.pdb ## Sample protein B: 1N4C.pdb --------------------------------------------------------------------------------
# Multiple sequence alignments (PIR format)
## Sample protein A: KCIP.pir
## Sample protein B: GAKH.pir.ORG -------------------------------------------------------------------------------- * MODELLER input files ** Sample protein A: *** ATM, *** ALI, *** TOP files (automatically generated) ** Sample protein B: *** ATM, *** ALI, *** TOP files (manually edited; C-terminal only) * MODELLER output files ** Sample protein A: KCIP.pdb ** Sample protein B: GAKH.pdb
buy ambien free ringtones nextel ringtones free nokia ringtones verizon ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Justin Timberlake concert tickets Shakira concert tickets Pink concert tickets buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Justin Timberlake concert tickets Shakira concert tickets motorcycle trailer Pink concert tickets buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Justin Timberlake concert tickets Shakira concert tickets motorcycle trailer Pink concert tickets buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Justin Timberlake concert tickets Shakira concert tickets motorcycle trailer Pink concert tickets verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones