Last 5 Pages Viewed: Protein modelling » Protein modelling » Protein modelling » Protein modelling » Protein modelling

Difference between revisions of "Protein modelling"

From Opengenome.net
(Cleaning up links to redisok.vnunetblogs.com)
 
(9 intermediate revisions by 9 users not shown)
Line 1: Line 1:
== [[단백질 구조 모델링]] 실용 안내서== <br /><br />[http://biome.ngic.re.kr/ProteinModelling/] <br /><br />===Problem (문제정의)=== <br />* Build 3D structural models of given or interested proteins <br />** Initial input: amino acid sequence of the target protein <br />** Final output: its predicted 3D structure <br /><br />===Method===<br />&nbsp;* Find one or more structural templates of the target protein via sequence homology search against known structures (program: BLASTP or PSI-BLAST, database: PDB)<br />* Download template structures in PDB format (web server: RCSB PDB) <br />* Align the amino acid sequence of the target protein with that(those) of the template protein(s) (program: CLUSTALW, output: PIR format) <br />* Build 3D structural models based on the multiple sequence alignment and the template 3D structure(s) (program: MODELLER, input: ATM, ALI, and TOP files) <br />** manual build <br />*** manually convert file formats from PDB to ATM and PIR to ALI, respectively <br />*** write a TOP script file <br />*** run MODELLER <br />** automatic build (some PDB and PIR files are not successfully converted to correct ATM and ALI files due to amino-acid sequence mismatch) <br />*** perl script to generate ATM, ALI, and TOP files from PDB and PIR files: [[perl script for ATM|txt]], gz <br />*** command-line arguments in order: base_directory_path pir_file_name target_protein_id(exactly 4 letters) one_or_more_PDB_file_names(exactly 4-letter prefix) <br />*** run the perl script (e.g. ../bin/makeModellerInput.pl /home/user/Protein3DModelling/KCIP KCIP.pir KCIP 1QJA.pdb) <br />*** run MODELLER (e.g. mod7v7 KCIP.top) <br /><br />** example <br />*** ATM file: 5fd1.atm <br />*** ALI file: alignment.ali <br />*** TOP file: model-default.top <br />*** command: mod7v7 model-default.top <br />*** output PDB file (predicted model): 1fdx.B99990001.pdb <br />** MODELLER manual <br />*** PDF, HTML<br /><br />&nbsp;* Display and compare the 3D structures of the model and the template proteins (program: RasMol) <br /><br />=== Sample proteins (단백질 예제들)=== <br />* Sample protein A: 14-3-3 protein gamma (Protein kinase C inhibitor protein-1; KCIP-1) >sw|P61981|143G_HUMAN 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWR VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKV FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV FYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD GGEGNN * Sample protein B: GAK_HUMAN Cyclin G-associated kinase (GAKH) >sw|O14976|GAK_HUMAN Cyclin G-associated kinase MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF <br /><br />=== Available Online Tool Servers === <br /># BLASTP: ## [http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi?CMD=Web&amp;LAYOUT=TwoWindows&amp;AUTO_FORMAT=Semiauto&amp;ALIGNMENTS=250&amp;ALIGNMENT_VIEW=Pairwise&amp;CDD_SEARCH=on&amp;CLIENT=web&amp;DATABASE=nr&amp;DESCRIPTIONS=500&amp;ENTREZ_QUERY=%28none%29&amp;EXPECT=10&amp;FILTER=L&amp;FORMAT_OBJECT=Alignment&amp;FORMAT_TYPE=HTML&amp;I_THRESH=0.005&amp;MATRIX_NAME=BLOSUM62&amp;NCBI_GI=on&amp;PAGE=Proteins&amp;PROGRAM=blastp&amp;SERVICE=plain&amp;SET_DEFAULTS.x=41&amp;SET_DEFAULTS.y=5&amp;SHOW_OVERVIEW=on&amp;END_OF_HTTPGET=Yes&amp;SHOW_LINKOUT=yes&amp;GET_SEQUENCE=yes 'NCBI BLASTP'] ## [http://srs.ebi.ac.uk/srsbin/cgi-bin/wgetz?-page+Launch+-id+1uBRI1Ot9iE+-appl+BlastP+-launchFrom+top EBI SRS BLASTP] <br /><br /># PSI-BLAST: <br />## [http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi?CMD=Web&amp;LAYOUT=TwoWindows&amp;AUTO_FORMAT=Semiauto&amp;ALIGNMENTS=250&amp;ALIGNMENT_VIEW=Pairwise&amp;CLIENT=web&amp;COMPOSITION_BASED_STATISTICS=on&amp;DATABASE=nr&amp;CDD_SEARCH=on&amp;DESCRIPTIONS=500&amp;ENTREZ_QUERY=%28none%29&amp;EXPECT= 'NCBI PSI-BLAST'] <br /># CLUSTALW: <br />## [http://www.ebi.ac.uk/clustalw/ 'EBI ClustalW'], <br />## [http://www.genebee.msu.su/clustal/basic.html 'Genebee ClustalW'] # SRS servers: 'NGIC SRS', 'Public SRS servers' # Search engine: Google (Search online servers by yourself!)   <br /><br />===Available Online Databases === <br /># PDB amino-acid FASTA file: NCBI BLAST DB (local: pdbaa.gz) # PDB: ## [http://www.rcsb.org/pdb/ RCSB], ## [http://pdb.ccdc.cam.ac.uk/pdb/ 'UK PDB mirror'], <br />## [http://pdb.protein.osaka-u.ac.jp/pdb/ 'Japan PDB mirror']   ===Downloadable programs=== # BLAST: ftp://ftp.ncbi.nlm.nih.gov/blast/executables/release/ (local: DOS) # CLUSTALW: ftp://ftp.ebi.ac.uk/pub/software/dos/clustalw/ (local: DOS[WindowsXP]) # MODELLER: http://salilab.org/modeller/ (local: DOS) # RasMol: http://www.openrasmol.org/ (local: Windows) # Perl: http://www.perl.org/ (local: DOS[WindowsXP]) # Other utilities: ALZip.exe (for unzip, untar, and ungzip)   <br /><br />===Solution Example === <br /># Found templates (PDB format) ## Sample protein A: [http://biome.ngic.re.kr/ProteinModelling/templates/1QJA.pdb 1QJA.pdb] ## Sample protein B: [http://biome.ngic.re.kr/ProteinModelling/templates/1N4C.pdb 1N4C.pdb]   -------------------------------------------------------------------------------- <br /># Multiple sequence alignments (PIR format) <br />## Sample protein A: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.pir KCIP.pir] <br />## Sample protein B: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/GAKH.pir.ORG GAKH.pir.ORG]   -------------------------------------------------------------------------------- * MODELLER input files ** Sample protein A: *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/1QJA.atm ATM], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.ali ALI], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.top TOP] files (automatically generated) ** Sample protein B: *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/1N4C.atm ATM], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.ali ALI], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/GAKH.top TOP] files (manually edited; C-terminal only)   * MODELLER output files ** Sample protein A: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.pdb KCIP.pdb] ** Sample protein B: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/GAKH.pdb GAKH.pdb]
+
== [[단백질 구조 모델링]] 실용 안내서== <br />
 +
<br />
 +
[http://biome.ngic.re.kr/ProteinModelling/] <br />
 +
<br />
 +
===Problem (문제정의)=== <br />
 +
* Build 3D structural models of given or interested proteins <br />
 +
** Initial input: amino acid sequence of the target protein <br />
 +
** Final output: its predicted 3D structure <br />
 +
<br />
 +
===Method===<br />
 +
&nbsp;* Find one or more structural templates of the target protein via sequence homology search against known structures (program: BLASTP or PSI-BLAST, database: PDB)<br />
 +
* Download template structures in PDB format (web server: RCSB PDB) <br />
 +
* Align the amino acid sequence of the target protein with that(those) of the template protein(s) (program: CLUSTALW, output: PIR format) <br />
 +
* Build 3D structural models based on the multiple sequence alignment and the template 3D structure(s) (program: MODELLER, input: ATM, ALI, and TOP files) <br />
 +
** manual build <br />
 +
*** manually convert file formats from PDB to ATM and PIR to ALI, respectively <br />
 +
*** write a TOP script file <br />
 +
*** run MODELLER <br />
 +
** automatic build (some PDB and PIR files are not successfully converted to correct ATM and ALI files due to amino-acid sequence mismatch) <br />
 +
*** perl script to generate ATM, ALI, and TOP files from PDB and PIR files: [[perl script for ATM|txt]], gz <br />
 +
*** command-line arguments in order: base_directory_path pir_file_name target_protein_id(exactly 4 letters) one_or_more_PDB_file_names(exactly 4-letter prefix) <br />
 +
*** run the perl script (e.g. ../bin/makeModellerInput.pl /home/user/Protein3DModelling/KCIP KCIP.pir KCIP 1QJA.pdb) <br />
 +
*** run MODELLER (e.g. mod7v7 KCIP.top) <br />
 +
<br />
 +
** example <br />
 +
*** ATM file: 5fd1.atm <br />
 +
*** ALI file: alignment.ali <br />
 +
*** TOP file: model-default.top <br />
 +
*** command: mod7v7 model-default.top <br />
 +
*** output PDB file (predicted model): 1fdx.B99990001.pdb <br />
 +
** MODELLER manual <br />
 +
*** PDF, HTML<br />
 +
<br />
 +
&nbsp;* Display and compare the 3D structures of the model and the template proteins (program: RasMol) <br />
 +
<br />
 +
=== Sample proteins (단백질 예제들)=== <br />
 +
* Sample protein A: 14-3-3 protein gamma (Protein kinase C inhibitor protein-1; KCIP-1) >sw|P61981|143G_HUMAN 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWR VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKV FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV FYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD GGEGNN * Sample protein B: GAK_HUMAN Cyclin G-associated kinase (GAKH) >sw|O14976|GAK_HUMAN Cyclin G-associated kinase MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF <br />
 +
<br />
 +
=== Available Online Tool Servers === <br />
 +
# BLASTP: ## [http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi?CMD=Web&amp;LAYOUT=TwoWindows&amp;AUTO_FORMAT=Semiauto&amp;ALIGNMENTS=250&amp;ALIGNMENT_VIEW=Pairwise&amp;CDD_SEARCH=on&amp;CLIENT=web&amp;DATABASE=nr&amp;DESCRIPTIONS=500&amp;ENTREZ_QUERY=%28none%29&amp;EXPECT=10&amp;FILTER=L&amp;FORMAT_OBJECT=Alignment&amp;FORMAT_TYPE=HTML&amp;I_THRESH=0.005&amp;MATRIX_NAME=BLOSUM62&amp;NCBI_GI=on&amp;PAGE=Proteins&amp;PROGRAM=blastp&amp;SERVICE=plain&amp;SET_DEFAULTS.x=41&amp;SET_DEFAULTS.y=5&amp;SHOW_OVERVIEW=on&amp;END_OF_HTTPGET=Yes&amp;SHOW_LINKOUT=yes&amp;GET_SEQUENCE=yes 'NCBI BLASTP'] ## [http://srs.ebi.ac.uk/srsbin/cgi-bin/wgetz?-page+Launch+-id+1uBRI1Ot9iE+-appl+BlastP+-launchFrom+top EBI SRS BLASTP] <br />
 +
<br />
 +
# PSI-BLAST: <br />
 +
## [http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi?CMD=Web&amp;LAYOUT=TwoWindows&amp;AUTO_FORMAT=Semiauto&amp;ALIGNMENTS=250&amp;ALIGNMENT_VIEW=Pairwise&amp;CLIENT=web&amp;COMPOSITION_BASED_STATISTICS=on&amp;DATABASE=nr&amp;CDD_SEARCH=on&amp;DESCRIPTIONS=500&amp;ENTREZ_QUERY=%28none%29&amp;EXPECT= 'NCBI PSI-BLAST'] <br />
 +
# CLUSTALW: <br />
 +
## [http://www.ebi.ac.uk/clustalw/ 'EBI ClustalW'], <br />
 +
## [http://www.genebee.msu.su/clustal/basic.html 'Genebee ClustalW'] # SRS servers: 'NGIC SRS', 'Public SRS servers' # Search engine: Google (Search online servers by yourself!) <br />
 +
<br />
 +
===Available Online Databases === <br />
 +
# PDB amino-acid FASTA file: NCBI BLAST DB (local: pdbaa.gz) # PDB: ## [http://www.rcsb.org/pdb/ RCSB], ## [http://pdb.ccdc.cam.ac.uk/pdb/ 'UK PDB mirror'], <br />
 +
## [http://pdb.protein.osaka-u.ac.jp/pdb/ 'Japan PDB mirror'] ===Downloadable programs=== # BLAST: ftp://ftp.ncbi.nlm.nih.gov/blast/executables/release/ (local: DOS) # CLUSTALW: ftp://ftp.ebi.ac.uk/pub/software/dos/clustalw/ (local: DOS[WindowsXP]) # MODELLER: http://salilab.org/modeller/ (local: DOS) # RasMol: http://www.openrasmol.org/ (local: Windows) # Perl: http://www.perl.org/ (local: DOS[WindowsXP]) # Other utilities: ALZip.exe (for unzip, untar, and ungzip) <br />
 +
<br />
 +
===Solution Example === <br />
 +
# Found templates (PDB format) ## Sample protein A: [http://biome.ngic.re.kr/ProteinModelling/templates/1QJA.pdb 1QJA.pdb] ## Sample protein B: [http://biome.ngic.re.kr/ProteinModelling/templates/1N4C.pdb 1N4C.pdb] -------------------------------------------------------------------------------- <br />
 +
# Multiple sequence alignments (PIR format) <br />
 +
## Sample protein A: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.pir KCIP.pir] <br />
 +
## Sample protein B: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/GAKH.pir.ORG GAKH.pir.ORG] -------------------------------------------------------------------------------- * MODELLER input files ** Sample protein A: *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/1QJA.atm ATM], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.ali ALI], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.top TOP] files (automatically generated) ** Sample protein B: *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/1N4C.atm ATM], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.ali ALI], *** [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/GAKH.top TOP] files (manually edited; C-terminal only) * MODELLER output files ** Sample protein A: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/KCIP/modellerResult/KCIP.pdb KCIP.pdb] ** Sample protein B: [http://biome.ngic.re.kr/ProteinModelling/buildingModels/GAKH/modellerResult/GAKH.pdb GAKH.pdb]
  
  
  
 
+
<div id="kbektt12951" style="overflow:auto;height:1px;">
 
+
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/5.html buy ambien]
 
+
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/6.html buy adipex]
 
+
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/7.html buy xenical]
 
+
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/8.html buy carisoprodol]
 
+
[http://www.fecaltransfusionfoundation.org/anyboard9/webmaster/posts/9.html buy hydrocodone]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/51.html buy ambien]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/52.html buy adipex]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/53.html buy xenical]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/54.html buy carisoprodol]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/55.html buy hydrocodone]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/56.html free ringtones]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/57.html nextel ringtones]
 
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/58.html free nokia ringtones]
<div id="kbektt12899" style="overflow:auto;height:1px;">
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/59.html verizon ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/220.html buy ambien]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/60.html free sprint ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/221.html buy adipex]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/61.html motorola ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/222.html buy xenical]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/62.html download ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/223.html buy valium]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/63.html cingular ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/224.html buy carisoprodol]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/64.html sprint ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/225.html buy hydrocodone]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/65.html polyphonic ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/226.html order phentermine]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/66.html cell phone wallpapers]
[http://www.superiormartialarts.com/Karate_Forum/posts/227.html anime wallpapers]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/67.html prepaid cell phones]
[http://www.superiormartialarts.com/Karate_Forum/posts/228.html desktop wallpapers]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/68.html mp3 ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/229.html cell phone wallpapers]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/69.html cell phone ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/230.html wallpaper borders]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/70.html download free ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/231.html free ringtones]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/71.html t-mobile ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/232.html nextel ringtones]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/72.html nokia ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/233.html free nokia ringtones]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/73.html free cingular ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/234.html verizon ringtones]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/74.html Justin Timberlake concert tickets]
[http://www.superiormartialarts.com/Karate_Forum/posts/235.html free sprint ringtones]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/75.html Shakira concert tickets]
[http://www.sc27.org/SC27Crew/posts/6.html motorola ringtones]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/76.html motorcycle trailer]
[http://www.sc27.org/SC27Crew/posts/7.html toddler beds]
+
[http://www.appli.se/rebecca/anyboard/myboard/posts/77.html Pink concert tickets]
[http://www.sc27.org/SC27Crew/posts/8.html download ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/163.html buy ambien]
[http://www.sc27.org/SC27Crew/posts/9.html cingular ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/164.html buy adipex]
[http://www.sc27.org/SC27Crew/posts/10.html sprint ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/165.html buy xenical]
[http://www.sc27.org/SC27Crew/posts/11.html laminate flooring]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/166.html buy carisoprodol]
[http://www.sc27.org/SC27Crew/posts/12.html baby strollers]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/167.html buy hydrocodone]
[http://www.sc27.org/SC27Crew/posts/13.html free ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/168.html free ringtones]
[http://www.sc27.org/SC27Crew/posts/14.html nextel ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/169.html nextel ringtones]
[http://www.sc27.org/SC27Crew/posts/15.html buy ambien]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/170.html free nokia ringtones]
[http://www.sc27.org/SC27Crew/posts/16.html buy adipex]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/171.html verizon ringtones]
[http://www.sc27.org/SC27Crew/posts/17.html buy xenical]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/172.html free sprint ringtones]
[http://www.sc27.org/SC27Crew/posts/18.html buy valium]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/173.html motorola ringtones]
[http://www.sc27.org/SC27Crew/posts/19.html buy carisoprodol]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/174.html download ringtones]
[http://www.sc27.org/SC27Crew/posts/20.html free nokia ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/175.html cingular ringtones]
[http://www.sc27.org/SC27Crew/posts/21.html verizon ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/176.html sprint ringtones]
[http://www.sc27.org/SC27Crew/posts/23.html free sprint ringtones]
+
[http://www.orangefridge.com/anyboard9/ryan/posts/177.html polyphonic ringtones]
[http://www.superiormartialarts.com/Karate_Forum/posts/237.html motorola ringtones]
+
[http://www.ohiospice.com/forum1/posts/11971.html buy ambien]
[http://www.superiormartialarts.com/Karate_Forum/posts/238.html download ringtones]
+
[http://www.ohiospice.com/forum1/posts/11972.html buy adipex]
[http://www.superiormartialarts.com/Karate_Forum/posts/239.html cingular ringtones]
+
[http://www.ohiospice.com/forum1/posts/11975.html buy xenical]
[http://www.superiormartialarts.com/Karate_Forum/posts/240.html sprint ringtones]
+
[http://www.ohiospice.com/forum1/posts/11976.html buy carisoprodol]
[http://pc-dmis.com/anyboard9/forum/posts/2396.html buy ambien]
+
[http://www.ohiospice.com/forum1/posts/11977.html buy hydrocodone]
[http://pc-dmis.com/anyboard9/forum/posts/2397.html buy adipex]
+
[http://www.ohiospice.com/forum1/posts/11978.html free ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2398.html buy xenical]
+
[http://www.ohiospice.com/forum1/posts/11979.html nextel ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2399.html buy valium]
+
[http://www.ohiospice.com/forum1/posts/11980.html free nokia ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2400.html buy carisoprodol]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2270.html free ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2401.html buy hydrocodone]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2271.html nextel ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2402.html free ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2272.html free nokia ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2403.html nextel ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2273.html verizon ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2404.html free nokia ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2274.html free sprint ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2405.html verizon ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2275.html motorola ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2406.html free sprint ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2276.html download ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2407.html motorola ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2277.html cingular ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2408.html download ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2278.html sprint ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2409.html cingular ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2279.html polyphonic ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2410.html sprint ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2280.html cell phone wallpapers]
[http://pc-dmis.com/anyboard9/forum/posts/2411.html cell phone wallpapers]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2281.html prepaid cell phones]
[http://pc-dmis.com/anyboard9/forum/posts/2412.html polyphonic ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2282.html mp3 ringtones]
[http://pc-dmis.com/anyboard9/forum/posts/2413.html toddler beds]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2283.html cell phone ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1213.html buy ambien]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2284.html download free ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1214.html buy adipex]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2285.html t-mobile ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1215.html buy xenical]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2286.html nokia ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1216.html buy valium]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2287.html free cingular ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1217.html buy carisoprodol]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2288.html Justin Timberlake concert tickets]
[http://www.tiggerstales.com/boards/bbs/posts/1218.html buy hydrocodone]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2289.html Shakira concert tickets]
[http://www.tiggerstales.com/boards/bbs/posts/1219.html free ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2290.html motorcycle trailer]
[http://www.tiggerstales.com/boards/bbs/posts/1220.html nextel ringtones]
+
[http://fudan7819.phm.utoronto.ca/fudan7819/posts/2291.html Pink concert tickets]
[http://www.tiggerstales.com/boards/bbs/posts/1221.html free nokia ringtones]
+
[http://www.ohiospice.com/forum1/posts/11984.html verizon ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1222.html verizon ringtones]
+
[http://www.ohiospice.com/forum1/posts/11985.html free sprint ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1223.html free sprint ringtones]
+
[http://www.ohiospice.com/forum1/posts/11986.html motorola ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1224.html motorola ringtones]
+
[http://www.ohiospice.com/forum1/posts/11987.html download ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1225.html laminate flooring]
+
[http://www.ohiospice.com/forum1/posts/11988.html cingular ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1226.html toddler beds]
+
[http://www.ohiospice.com/forum1/posts/11989.html sprint ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1227.html download ringtones]
+
[http://www.ohiospice.com/forum1/posts/11990.html polyphonic ringtones]
[http://www.tiggerstales.com/boards/bbs/posts/1228.html cingular ringtones]
+
[http://www.ohiospice.com/forum1/posts/11991.html cell phone wallpapers]
[http://www.tiggerstales.com/boards/bbs/posts/1229.html sprint ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/167.html buy ambien]
[http://www.tiggerstales.com/boards/bbs/posts/1230.html cell phone wallpapers]
+
[http://www.casstelephone.com/bbs/general/posts/168.html buy adipex]
[http://www.tiggerstales.com/boards/bbs/posts/1231.html polyphonic ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/169.html buy xenical]
[http://www.tiggerstales.com/boards/bbs/posts/1232.html electric wheelchair]
+
[http://www.casstelephone.com/bbs/general/posts/170.html buy carisoprodol]
[http://www.indianink.net/forums/Tips/posts/4281.html buy ambien]
+
[http://www.casstelephone.com/bbs/general/posts/171.html buy hydrocodone]
[http://www.indianink.net/forums/Tips/posts/4283.html buy adipex]
+
[http://www.casstelephone.com/bbs/general/posts/172.html free ringtones]
[http://www.indianink.net/forums/Tips/posts/4284.html buy xenical]
+
[http://www.casstelephone.com/bbs/general/posts/173.html nextel ringtones]
[http://www.indianink.net/forums/Tips/posts/4286.html buy valium]
+
[http://www.casstelephone.com/bbs/general/posts/174.html free nokia ringtones]
[http://www.indianink.net/forums/Tips/posts/4287.html buy carisoprodol]
+
[http://www.casstelephone.com/bbs/general/posts/175.html verizon ringtones]
[http://www.indianink.net/forums/Tips/posts/4289.html buy hydrocodone]
+
[http://www.casstelephone.com/bbs/general/posts/176.html free sprint ringtones]
[http://www.indianink.net/forums/Tips/posts/4291.html free ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/177.html motorola ringtones]
[http://www.indianink.net/forums/Tips/posts/4292.html nextel ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/178.html download ringtones]
[http://www.indianink.net/forums/Tips/posts/4293.html free nokia ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/179.html cingular ringtones]
[http://www.indianink.net/forums/Tips/posts/4295.html verizon ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/180.html sprint ringtones]
[http://www.indianink.net/forums/Tips/posts/4296.html free sprint ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/181.html polyphonic ringtones]
[http://www.indianink.net/forums/Tips/posts/4297.html motorola ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/182.html cell phone wallpapers]
[http://www.indianink.net/forums/Tips/posts/4299.html toddler beds]
+
[http://www.casstelephone.com/bbs/general/posts/183.html prepaid cell phones]
[http://www.indianink.net/forums/Tips/posts/4300.html cingular ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/184.html mp3 ringtones]
[http://www.indianink.net/forums/Tips/posts/4301.html polyphonic ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/185.html cell phone ringtones]
[http://www.indianink.net/forums/Tips/posts/4303.html cell phone wallpapers]
+
[http://www.casstelephone.com/bbs/general/posts/186.html download free ringtones]
[http://www.indianink.net/forums/Tips/posts/4431.html laminate flooring]
+
[http://www.casstelephone.com/bbs/general/posts/187.html t-mobile ringtones]
[http://www.indianink.net/forums/Tips/posts/4433.html download ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/188.html nokia ringtones]
[http://www.indianink.net/forums/Tips/posts/4434.html sprint ringtones]
+
[http://www.casstelephone.com/bbs/general/posts/189.html free cingular ringtones]
[http://www.indianink.net/forums/Tips/posts/4435.html electric wheelchair]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/9.html buy ambien]
[http://www.desert-tropicals.com/bbs/posts/7322.html buy ambien]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/10.html buy adipex]
[http://www.desert-tropicals.com/bbs/posts/7323.html buy adipex]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/11.html buy xenical]
[http://www.desert-tropicals.com/bbs/posts/7324.html buy xenical]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/12.html buy carisoprodol]
[http://www.desert-tropicals.com/bbs/posts/7325.html buy valium]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/13.html buy hydrocodone]
[http://www.desert-tropicals.com/bbs/posts/7326.html buy carisoprodol]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/14.html free ringtones]
[http://www.desert-tropicals.com/bbs/posts/7327.html buy hydrocodone]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/15.html nextel ringtones]
[http://www.desert-tropicals.com/bbs/posts/7329.html laminate flooring]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/16.html free nokia ringtones]
[http://www.desert-tropicals.com/bbs/posts/7330.html toddler beds]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/17.html verizon ringtones]
[http://www.desert-tropicals.com/bbs/posts/7331.html cell phone wallpapers]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/18.html free sprint ringtones]
[http://www.desert-tropicals.com/bbs/posts/7332.html electric wheelchair]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/19.html motorola ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1823.html free ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/20.html download ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1824.html nextel ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/21.html cingular ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1825.html free nokia ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/22.html sprint ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1826.html verizon ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/23.html polyphonic ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1827.html free sprint ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/24.html cell phone wallpapers]
[http://www.finnmark-slekt.com/finnquery/posts/1828.html motorola ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/25.html prepaid cell phones]
[http://www.finnmark-slekt.com/finnquery/posts/1829.html download ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/26.html mp3 ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1830.html cingular ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/27.html cell phone ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1831.html sprint ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/28.html download free ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1832.html polyphonic ringtones]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/29.html t-mobile ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1833.html cell phone wallpapers]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/30.html nokia ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1838.html buy ambien]
+
[http://www.drbradsadvice.com/anyboard9/forum/posts/31.html free cingular ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1839.html buy adipex]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/38.html buy ambien]
[http://www.finnmark-slekt.com/finnquery/posts/1840.html buy xenical]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/39.html buy adipex]
[http://www.finnmark-slekt.com/finnquery/posts/1841.html buy carisoprodol]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/40.html buy xenical]
[http://www.finnmark-slekt.com/finnquery/posts/1842.html buy hydrocodone]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/41.html buy carisoprodol]
[http://www.finnmark-slekt.com/finnquery/posts/1843.html didrex]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/42.html buy hydrocodone]
[http://www.finnmark-slekt.com/finnquery/posts/1844.html diazepam]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/43.html free ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1845.html toddler beds]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/44.html nextel ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1846.html laminate flooring]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/45.html free nokia ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1847.html electric wheelchair]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/46.html verizon ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1855.html prepaid cell phones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/47.html free sprint ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1856.html mp3 ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/48.html motorola ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1858.html cell phone ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/49.html download ringtones]
[http://www.finnmark-slekt.com/finnquery/posts/1859.html download free ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/50.html cingular ringtones]
[http://forum.lantbruksnet.se/batnet/posts/5309.html free ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/51.html sprint ringtones]
[http://forum.lantbruksnet.se/batnet/posts/5310.html nextel ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/52.html polyphonic ringtones]
[http://forum.lantbruksnet.se/batnet/posts/5311.html free nokia ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/53.html cell phone wallpapers]
[http://forum.lantbruksnet.se/batnet/posts/5312.html verizon ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/54.html prepaid cell phones]
[http://forum.lantbruksnet.se/batnet/posts/5313.html free sprint ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/55.html mp3 ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11492.html motorola ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/56.html cell phone ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11493.html download ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/57.html download free ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11494.html cingular ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/58.html t-mobile ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11495.html sprint ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/59.html nokia ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11496.html polyphonic ringtones]
+
[http://www.therealuntouchables.com/anyboard/anyboard9/forum/posts/60.html free cingular ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11498.html cell phone wallpapers]
+
[http://www.getechnet.com/board/board/forum/posts/71.html buy ambien]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11499.html prepaid cell phones]
+
[http://www.getechnet.com/board/board/forum/posts/72.html buy adipex]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11500.html mp3 ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/73.html buy xenical]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11501.html cell phone ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/74.html buy carisoprodol]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11502.html download free ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/75.html buy hydrocodone]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11503.html t-mobile ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/76.html free ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11504.html nokia ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/77.html nextel ringtones]
[http://forum.lantbruksnet.se/lantbruksnet/posts/11505.html free cingular ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/78.html free nokia ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/663.html ambien]
+
[http://www.getechnet.com/board/board/forum/posts/79.html verizon ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/664.html adipex]
+
[http://www.getechnet.com/board/board/forum/posts/80.html free sprint ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/665.html xenical]
+
[http://www.getechnet.com/board/board/forum/posts/81.html motorola ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/666.html didrex]
+
[http://www.getechnet.com/board/board/forum/posts/83.html download ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/667.html free ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/84.html cingular ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/668.html nextel ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/85.html sprint ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/669.html free nokia ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/86.html polyphonic ringtones]
[http://www.sweepersonline.com/virtualsweeperforum/posts/670.html verizon ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/87.html cell phone wallpapers]
[http://www.sweepersonline.com/virtualsweeperforum/posts/671.html free sprint ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/88.html prepaid cell phones]
[http://www.sweepersonline.com/bidboardforum/posts/1483.html motorola ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/89.html mp3 ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1484.html download ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/90.html cell phone ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1485.html cingular ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/91.html download free ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1486.html sprint ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/92.html t-mobile ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1487.html polyphonic ringtones]
+
[http://www.getechnet.com/board/board/forum/posts/93.html nokia ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1488.html cell phone wallpapers]
+
[http://www.getechnet.com/board/board/forum/posts/94.html free cingular ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1489.html prepaid cell phones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/5.html buy ambien]
[http://www.sweepersonline.com/bidboardforum/posts/1490.html mp3 ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/6.html buy adipex]
[http://www.sweepersonline.com/bidboardforum/posts/1491.html cell phone ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/7.html buy xenical]
[http://www.sweepersonline.com/bidboardforum/posts/1492.html download free ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/8.html buy carisoprodol]
[http://www.sweepersonline.com/bidboardforum/posts/1493.html t-mobile ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/9.html buy hydrocodone]
[http://www.sweepersonline.com/bidboardforum/posts/1494.html nokia ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/10.html free ringtones]
[http://www.sweepersonline.com/bidboardforum/posts/1495.html free cingular ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/11.html nextel ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/525.html ambien]
+
[http://images.gosupernet.net/anyboard9/forum/posts/12.html free nokia ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/526.html adipex]
+
[http://images.gosupernet.net/anyboard9/forum/posts/13.html verizon ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/527.html xenical]
+
[http://images.gosupernet.net/anyboard9/forum/posts/14.html free sprint ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/528.html didrex]
+
[http://images.gosupernet.net/anyboard9/forum/posts/15.html motorola ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1124.html ambien]
+
[http://images.gosupernet.net/anyboard9/forum/posts/16.html download ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1135.html adipex]
+
[http://images.gosupernet.net/anyboard9/forum/posts/17.html cingular ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1136.html xenical]
+
[http://images.gosupernet.net/anyboard9/forum/posts/18.html sprint ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1137.html didrex]
+
[http://images.gosupernet.net/anyboard9/forum/posts/19.html polyphonic ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1138.html free ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/20.html cell phone wallpapers]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1139.html nextel ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/21.html prepaid cell phones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1140.html free nokia ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/22.html mp3 ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1141.html verizon ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/23.html cell phone ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1142.html free sprint ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/24.html download free ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1143.html motorola ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/25.html t-mobile ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1144.html download ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/26.html nokia ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1145.html cingular ringtones]
+
[http://images.gosupernet.net/anyboard9/forum/posts/27.html free cingular ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1146.html sprint ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/5.html buy ambien]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1147.html polyphonic ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/6.html buy adipex]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1148.html cell phone wallpapers]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/7.html buy xenical]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1149.html prepaid cell phones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/8.html buy carisoprodol]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1150.html mp3 ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/9.html buy hydrocodone]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1151.html cell phone ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/10.html free ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1152.html download free ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/11.html nextel ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1153.html t-mobile ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/12.html free nokia ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1154.html nokia ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/13.html verizon ringtones]
[http://www.69indianporn.com/cgi-local/board/69indianporn/posts/1155.html free cingular ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/14.html free sprint ringtones]
[http://www.hartsville.net/betatest/posts/12.html ambien]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/15.html motorola ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/529.html free ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/16.html download ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/530.html nextel ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/17.html cingular ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/531.html free nokia ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/18.html sprint ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/532.html verizon ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/19.html polyphonic ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/533.html free sprint ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/20.html cell phone wallpapers]
[http://www.humancloning.org/anyboard9/contactus/posts/534.html motorola ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/21.html prepaid cell phones]
[http://www.humancloning.org/anyboard9/contactus/posts/535.html download ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/22.html mp3 ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/536.html cingular ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/23.html cell phone ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/537.html sprint ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/24.html download free ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/538.html polyphonic ringtones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/25.html t-mobile ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/539.html cell phone wallpapers]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/26.html nokia ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/540.html prepaid cell phones]
+
[http://www.bacteriophage.org/anyboard9/forum/posts/27.html free cingular ringtones]
[http://www.humancloning.org/anyboard9/contactus/posts/541.html mp3 ringtones]
+
[http://bamiko.blogspot.com/ Blog]
[http://www.humancloning.org/anyboard9/contactus/posts/542.html cell phone ringtones]
+
[http://travikk.blogspot.com/ Blog]
[http://www.humancloning.org/anyboard9/contactus/posts/543.html download free ringtones]
+
[http://slartiy.blogspot.com/ Blog]
[http://www.humancloning.org/anyboard9/contactus/posts/544.html t-mobile ringtones]
+
[http://alopka.blogspot.com/ Blog]
[http://www.humancloning.org/anyboard9/contactus/posts/545.html nokia ringtones]
+
[http://relikas.blogspot.com/ Blog]
[http://www.humancloning.org/anyboard9/contactus/posts/546.html free cingular ringtones]
+
[http://graiett.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/13.html adipex]
+
[http://goldres.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/14.html xenical]
+
[http://gretad.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/15.html didrex]
+
[http://travill.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/16.html free ringtones]
+
[http://trekdo.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/17.html nextel ringtones]
+
[http://grotyk.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/18.html free nokia ringtones]
+
[http://bimkol.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/19.html verizon ringtones]
+
[http://jokertak.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/20.html free sprint ringtones]
+
[http://slopsa.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/21.html motorola ringtones]
+
[http://kolaset.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/22.html download ringtones]
+
[http://errasik.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/23.html cingular ringtones]
+
[http://kristaho.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/24.html sprint ringtones]
+
[http://tranata.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/25.html polyphonic ringtones]
+
[http://fretoll.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/26.html cell phone wallpapers]
+
[http://cderka.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/27.html prepaid cell phones]
+
[http://stalko.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/28.html mp3 ringtones]
+
[http://nokals.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/29.html cell phone ringtones]
+
[http://mangurik.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/30.html download free ringtones]
+
[http://desanko.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/31.html t-mobile ringtones]
+
[http://krasolik.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/32.html nokia ringtones]
+
[http://remonts.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/33.html free cingular ringtones]
+
[http://koldret.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/34.html Justin Timberlake concert tickets]
+
[http://sharlik.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/35.html Shakira concert tickets]
+
[http://davirta.blogspot.com/ Blog]
[http://www.hartsville.net/betatest/posts/36.html Pink concert tickets]
+
[http://demipo.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/346.html buy ambien]
+
[http://dafaty.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/347.html buy adipex]
+
[http://aleksok.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/348.html buy xenical]
+
[http://tonukk.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/349.html buy carisoprodol]
+
[http://hakolad.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/350.html buy hydrocodone]
+
[http://stareik.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/351.html free ringtones]
+
[http://allared.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/352.html nextel ringtones]
+
[http://umoreska.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/353.html free nokia ringtones]
+
[http://karetsa.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/354.html verizon ringtones]
+
[http://proviks.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/355.html free sprint ringtones]
+
[http://myshans.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/356.html motorola ringtones]
+
[http://leskamne.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/357.html download ringtones]
+
[http://dushes.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/358.html Justin Timberlake concert tickets]
+
[http://sobachk.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/359.html Shakira concert tickets]
+
[http://loshady.blogspot.com/ Blog]
[http://northstar.northseattle.edu/discussions/cis111dl-kent/posts/360.html Pink concert tickets]
+
[http://prorabb.blogspot.com/ Blog]
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1528.html cingular ringtones]
+
[http://kommunik.blogspot.com/ Blog]
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1529.html sprint ringtones]
+
[http://travolki.blogspot.com/ Blog]
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1530.html polyphonic ringtones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1531.html cell phone wallpapers]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1532.html prepaid cell phones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1533.html mp3 ringtones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1534.html cell phone ringtones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1535.html download free ringtones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1536.html t-mobile ringtones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1537.html nokia ringtones]
 
[http://northstar.sccd.ctc.edu/discussions/csc143-goldner/posts/1538.html free cingular ringtones]
 
[http://www.mhrk.it/forum/posts/5.html buy ambien]
 
[http://www.mhrk.it/forum/posts/6.html buy adipex]
 
[http://www.mhrk.it/forum/posts/7.html buy xenical]
 
[http://www.mhrk.it/forum/posts/8.html buy carisoprodol]
 
[http://www.mhrk.it/forum/posts/9.html buy hydrocodone]
 
[http://www.mhrk.it/forum/posts/10.html motorcycle trailer]
 
[http://www.mhrk.it/forum/posts/11.html free ringtones]
 
[http://www.mhrk.it/forum/posts/12.html nextel ringtones]
 
[http://www.mhrk.it/forum/posts/13.html free nokia ringtones]
 
[http://www.mhrk.it/forum/posts/14.html verizon ringtones]
 
[http://www.mhrk.it/forum/posts/15.html free sprint ringtones]
 
[http://www.mhrk.it/forum/posts/16.html motorola ringtones]
 
[http://www.mhrk.it/forum/posts/17.html download ringtones]
 
[http://www.mhrk.it/forum/posts/18.html cingular ringtones]
 
[http://www.mhrk.it/forum/posts/19.html sprint ringtones]
 
[http://www.mhrk.it/forum/posts/20.html polyphonic ringtones]
 
[http://www.mhrk.it/forum/posts/21.html cell phone wallpapers]
 
[http://www.mhrk.it/forum/posts/22.html prepaid cell phones]
 
[http://www.mhrk.it/forum/posts/23.html mp3 ringtones]
 
[http://www.mhrk.it/forum/posts/24.html cell phone ringtones]
 
[http://www.mhrk.it/forum/posts/25.html download free ringtones]
 
[http://www.mhrk.it/forum/posts/26.html t-mobile ringtones]
 
[http://www.mhrk.it/forum/posts/27.html nokia ringtones]
 
[http://www.mhrk.it/forum/posts/28.html free cingular ringtones]
 
[http://www.mhrk.it/forum/posts/29.html Justin Timberlake concert tickets]
 
[http://www.mhrk.it/forum/posts/30.html Shakira concert tickets]
 
[http://www.mhrk.it/forum/posts/31.html Pink concert tickets]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/8.html buy ambien]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/9.html buy adipex]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/10.html buy xenical]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/11.html buy carisoprodol]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/12.html buy hydrocodone]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/13.html free ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/14.html nextel ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/15.html free nokia ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/16.html verizon ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/17.html free sprint ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/18.html motorola ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/19.html download ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/20.html cingular ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/21.html sprint ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/22.html polyphonic ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/23.html cell phone wallpapers]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/24.html prepaid cell phones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/25.html mp3 ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/26.html cell phone ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/27.html download free ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/28.html t-mobile ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/29.html nokia ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/30.html free cingular ringtones]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/31.html Justin Timberlake concert tickets]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/32.html Shakira concert tickets]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/33.html Pink concert tickets]
 
[http://www.religiousleft.com/anyboard9/masterforum/posts/34.html motorcycle trailer]
 
[http://www.nonsmall.org/anyboard9/contactus/posts/8.html buy ambien]
 
 
</div>
 
</div>

Latest revision as of 16:01, 30 March 2011

== 단백질 구조 모델링 실용 안내서==

[1]

===Problem (문제정의)===

  • Build 3D structural models of given or interested proteins
    • Initial input: amino acid sequence of the target protein
    • Final output: its predicted 3D structure


===Method===
 * Find one or more structural templates of the target protein via sequence homology search against known structures (program: BLASTP or PSI-BLAST, database: PDB)

  • Download template structures in PDB format (web server: RCSB PDB)
  • Align the amino acid sequence of the target protein with that(those) of the template protein(s) (program: CLUSTALW, output: PIR format)
  • Build 3D structural models based on the multiple sequence alignment and the template 3D structure(s) (program: MODELLER, input: ATM, ALI, and TOP files)
    • manual build
      • manually convert file formats from PDB to ATM and PIR to ALI, respectively
      • write a TOP script file
      • run MODELLER
    • automatic build (some PDB and PIR files are not successfully converted to correct ATM and ALI files due to amino-acid sequence mismatch)
      • perl script to generate ATM, ALI, and TOP files from PDB and PIR files: txt, gz
      • command-line arguments in order: base_directory_path pir_file_name target_protein_id(exactly 4 letters) one_or_more_PDB_file_names(exactly 4-letter prefix)
      • run the perl script (e.g. ../bin/makeModellerInput.pl /home/user/Protein3DModelling/KCIP KCIP.pir KCIP 1QJA.pdb)
      • run MODELLER (e.g. mod7v7 KCIP.top)


    • example
      • ATM file: 5fd1.atm
      • ALI file: alignment.ali
      • TOP file: model-default.top
      • command: mod7v7 model-default.top
      • output PDB file (predicted model): 1fdx.B99990001.pdb
    • MODELLER manual
      • PDF, HTML


 * Display and compare the 3D structures of the model and the template proteins (program: RasMol)

=== Sample proteins (단백질 예제들)===

  • Sample protein A: 14-3-3 protein gamma (Protein kinase C inhibitor protein-1; KCIP-1) >sw|P61981|143G_HUMAN 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWR VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKV FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV FYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD GGEGNN * Sample protein B: GAK_HUMAN Cyclin G-associated kinase (GAKH) >sw|O14976|GAK_HUMAN Cyclin G-associated kinase MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF


=== Available Online Tool Servers ===

  1. BLASTP: ## 'NCBI BLASTP' ## EBI SRS BLASTP


  1. PSI-BLAST:
    1. 'NCBI PSI-BLAST'
  2. CLUSTALW:
    1. 'EBI ClustalW',
    2. 'Genebee ClustalW' # SRS servers: 'NGIC SRS', 'Public SRS servers' # Search engine: Google (Search online servers by yourself!)


===Available Online Databases ===

  1. PDB amino-acid FASTA file: NCBI BLAST DB (local: pdbaa.gz) # PDB: ## RCSB, ## 'UK PDB mirror',
    1. 'Japan PDB mirror' ===Downloadable programs=== # BLAST: ftp://ftp.ncbi.nlm.nih.gov/blast/executables/release/ (local: DOS) # CLUSTALW: ftp://ftp.ebi.ac.uk/pub/software/dos/clustalw/ (local: DOS[WindowsXP]) # MODELLER: http://salilab.org/modeller/ (local: DOS) # RasMol: http://www.openrasmol.org/ (local: Windows) # Perl: http://www.perl.org/ (local: DOS[WindowsXP]) # Other utilities: ALZip.exe (for unzip, untar, and ungzip)


===Solution Example ===

  1. Found templates (PDB format) ## Sample protein A: 1QJA.pdb ## Sample protein B: 1N4C.pdb --------------------------------------------------------------------------------
  2. Multiple sequence alignments (PIR format)
    1. Sample protein A: KCIP.pir
    2. Sample protein B: GAKH.pir.ORG -------------------------------------------------------------------------------- * MODELLER input files ** Sample protein A: *** ATM, *** ALI, *** TOP files (automatically generated) ** Sample protein B: *** ATM, *** ALI, *** TOP files (manually edited; C-terminal only) * MODELLER output files ** Sample protein A: KCIP.pdb ** Sample protein B: GAKH.pdb


buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Justin Timberlake concert tickets Shakira concert tickets motorcycle trailer Pink concert tickets buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Justin Timberlake concert tickets Shakira concert tickets motorcycle trailer Pink concert tickets verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones buy ambien buy adipex buy xenical buy carisoprodol buy hydrocodone free ringtones nextel ringtones free nokia ringtones verizon ringtones free sprint ringtones motorola ringtones download ringtones cingular ringtones sprint ringtones polyphonic ringtones cell phone wallpapers prepaid cell phones mp3 ringtones cell phone ringtones download free ringtones t-mobile ringtones nokia ringtones free cingular ringtones Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog Blog